PRR5 Antibody - middle region : FITC

PRR5 Antibody - middle region : FITC
Artikelnummer
AVIARP58943_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian target of rapamycin complex 2 (mTORC2), and it regulates platelet-derived growth factor (PDGF) receptor beta expression and PDGF signaling to Akt and S6K1. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. Read-through transcripts from this gene into the downstream Rho GTPase activating protein 8 (ARHGAP8) gene also exist, which led to the original description of PRR5 and ARHGAP8 being a single gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPR5

Molecular Weight: 31 kDa

Peptide Sequence: Synthetic peptide located within the following region: TLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRSGDVLAKNPVVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline-rich protein 5

Protein Size: 287

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58943_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58943_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55615
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×