PSCD4 Antibody - N-terminal region : Biotin

PSCD4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54947_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSCD4

Key Reference: Morishige,M., (2008) Nat. Cell Biol. 10 (1), 85-92

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytohesin-4

Protein Size: 394

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54947_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54947_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27128
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×