PSEN2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PSEN2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: presenilin-2

Protein Size: 304

Purification: Affinity Purified

• Artikelnummer: AVIARP58940_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58940_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5664
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin