PSEN2 Antibody - C-terminal region : FITC

PSEN2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58940_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PSEN2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: presenilin-2

Protein Size: 304

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58940_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58940_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5664
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×