Psma2 Antibody - C-terminal region : FITC

Psma2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56454_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Psma2 is a component of the proteasome multicatalytic proteinase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit alpha type-2

Protein Size: 234

Purification: Affinity Purified

Subunit: alpha type-2
Mehr Informationen
Artikelnummer AVIARP56454_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56454_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29669
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×