PSMC4 Antibody - N-terminal region : FITC

PSMC4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56715_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC4

Key Reference: Marx,F.P., (2007) FASEB J. 21 (8), 1759-1767

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S protease regulatory subunit 6B

Protein Size: 418

Purification: Affinity Purified

Subunit: 6B
Mehr Informationen
Artikelnummer AVIARP56715_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56715_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5704
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×