Psmd10 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Psmd10 acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly,Psmd10 is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module By similarity.Psmd10 acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression of this gene is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Psmd10 regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 10

Protein Size: 231

Purification: Affinity Purified

Subunit: 10

• Artikelnummer: AVIARP56481_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56481_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 53380
• Wirt: Rabbit