PTPN11 Antibody - N-terminal region : HRP

PTPN11 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56494_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTPN11

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: HPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein phosphatase non-receptor type 11

Protein Size: 593

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56494_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56494_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5781
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×