Ptprc Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ptprc is a member of a family of heavily glycosylated leukocyte cell surface glycoproteins; It displays extensive O-glycosylation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ptprc

Molecular Weight: 140kDa

Peptide Sequence: Synthetic peptide located within the following region: FLVFLIIVTSIALLVVLYKIYDLRKKRSSNLDEQQELVERDEEKQLINVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Receptor-type tyrosine-protein phosphatase C

Protein Size: 1273

Purification: Affinity Purified

• Artikelnummer: AVIARP59108_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59108_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 24699
• Wirt: Rabbit
• Konjugat: Conjugated, HRP