QARS Antibody - N-terminal region : Biotin

QARS Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56628_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human QARS

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamine--tRNA ligase

Protein Size: 775

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56628_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56628_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5859
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×