R3HDM2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human R3HDM2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: R3H domain-containing protein 2

Protein Size: 637

Purification: Affinity Purified

• Artikelnummer: AVIARP55106_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55106_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22864
• Wirt: Rabbit