RAB11FIP5 Antibody - N-terminal region : FITC

RAB11FIP5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55260_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB11FIP5 is a Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP5

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rab11 family-interacting protein 5

Protein Size: 653

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55260_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55260_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26056
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×