RAB22A Antibody - middle region : HRP

RAB22A Antibody - middle region : HRP
Artikelnummer
AVIARP57434_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-22A

Protein Size: 194

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57434_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57434_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 57403
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×