RAB37 Antibody - middle region : FITC

RAB37 Antibody - middle region : FITC
Artikelnummer
AVIARP55738_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB37

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-37

Protein Size: 216

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55738_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55738_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 326624
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×