RAB39 Antibody - N-terminal region : FITC

RAB39 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56965_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB39 may be involved in vesicular trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB39

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-39A

Protein Size: 217

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56965_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56965_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54734
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×