RAB3IL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB3IL1

Key Reference: Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide exchange factor for Rab-3A

Protein Size: 382

Purification: Affinity Purified

• Artikelnummer: AVIARP56739_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56739_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5866
• Wirt: Rabbit