RABGEF1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RABGEF1

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ75284, highly similar to Homo sapiens RAB guanine nucleotide exchange factor (GEF) 1 (RABGEF1), mRNA EMBL BAF83367.1

Protein Size: 491

Purification: Affinity Purified

• Artikelnummer: AVIARP55073_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55073_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27342
• Wirt: Rabbit