RALB Antibody - middle region : HRP

RALB Antibody - middle region : HRP
Artikelnummer
AVIARP56508_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RALB

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Ral-B

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56508_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56508_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5899
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×