RALGPS2 Antibody - N-terminal region : HRP

RALGPS2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57091_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human RALGPS2

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS2

Protein Size: 279

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57091_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57091_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55103
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×