English
RANBP3 Antibody - N-terminal region : HRP
RANBP3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58520_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP3
Key Reference: Yoon,S.O., (2008) Mol. Cell 29 (3), 362-375
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ran-binding protein 3
Protein Size: 567
Purification: Affinity Purified
Description of Target: RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANBP3
Key Reference: Yoon,S.O., (2008) Mol. Cell 29 (3), 362-375
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ran-binding protein 3
Protein Size: 567
Purification: Affinity Purified
| Artikelnummer | AVIARP58520_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58520_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 8498 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
