RANGAP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGA

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANGAP1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ran GTPase-activating protein 1

Protein Size: 587

Purification: Affinity Purified

• Artikelnummer: AVIARP56509_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56509_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5905
• Wirt: Rabbit