Rap1a Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rap1a induces morphological reversion of a cell line transformed by a Ras oncogene. Rap1a counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Rap1a

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: DLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rap-1A

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP56195_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56195_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 109905
• Wirt: Rabbit