RAP1GAP Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Key Reference: Mitra,R.S., (2008) Cancer Res. 68 (10), 3959-3969

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified

• Artikelnummer: AVIARP56511_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56511_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5909
• Wirt: Rabbit