RASGRP2 Antibody - N-terminal region : Biotin

RASGRP2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58820_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRP2

Key Reference: Katagiri,K., (2004) J. Biol. Chem. 279 (12), 11875-11881

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RAS guanyl-releasing protein 2

Protein Size: 609

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58820_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58820_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10235
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×