BVR Protein

Rat Natural BVR Full Length Protein
Artikelnummer
STRSPR-320C
Verpackungseinheit
100 µg x2
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: BVR .

Nature: Natural.

Swiss-Prot: P46844.

Expression System: Native.

Protein Length: Full Length.

Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK.

Purification: Ion-exchange Purified.

Purity: >90%.

Storage Buffer: 10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol.

Protein Size: ~36 kDa.

Conjugate: No tag.

Cellular Localization: Cytoplasm.

Scientific Background: Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).

References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789.2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962.3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-320C
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-320C
Green Labware Nein
Verpackungseinheit 100 µg x2
Mengeneinheit PAK
Reaktivität Rat (Rattus)
Methode Western Blotting, SDS-PAGE
Human Gene ID 116599
Produktinformation (PDF) Download
MSDS (PDF) Download