RBBP7 Antibody - middle region : HRP

RBBP7 Antibody - middle region : HRP
Artikelnummer
AVIARP56518_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBBP7

Key Reference: Thakur,A., (2007) Mol. Cancer Res. 5 (2), 171-181

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone-binding protein RBBP7

Protein Size: 425

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56518_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56518_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5931
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×