Recombinant Human BAZ1B Protein

Recombinant Human BAZ1B Protein
Artikelnummer
ASBPP-2899-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIG0

Gene Name: BAZ1B

Expression System: Escherichia coli

Molecular Weight: 40.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Glu541

End Site: Gln870

Coverage: 0.22

Isoelectric Point: 5.5

Core Sequence: EQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSDVQEESEGSDTDDNKDSAAFEDNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMISAVKSRRLLAIQAKKEREIQEREMKVKLERQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: WBSC10; WBSCR10; WBSCR9; WSTF

Alternative protein names: Tyrosine-protein kinase BAZ1B; Bromodomain adjacent to zinc finger domain protein 1B; Williams syndrome transcription factor; Williams-Beuren syndrome chromosomal region 10 protein; Williams-Beuren syndrome chromosomal region 9 protein; hWALp2

Protein name: bromodomain adjacent to zinc finger domain 1B

Full length: 1483 amino acids

Entry name: BAZ1B_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
Mehr Informationen
Artikelnummer ASBPP-2899-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-2899-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 9031
Produktinformation (PDF)
×
MSDS (PDF)
×