Recombinant Human BICC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H694

Gene Name: BICC1

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ser31

End Site: Arg200

Coverage: 0.18

Isoelectric Point: 8

Core Sequence: SEDDLVAGATLHSPEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 35%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protein bicaudal C homolog 1; Bic-C

Protein name: BicC family RNA binding protein 1

Full length: 974 amino acids

Entry name: BICC1_HUMAN

• Artikelnummer: ASBPP-2767-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2767-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80114