Note: Dry Ice fees will be extra-charged
Uniprot: Q9NX62
Gene Name: BPNT2
Expression System: Escherichia coli
Molecular Weight: 15 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 90%
Start Site: Val71
End Site: Gln180
Coverage: 0.34
Isoelectric Point: 5.5
Core Sequence: VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 94%, Cynomolgus monkey - 100%
Alternative gene names: IMPA3; IMPAD1
Alternative protein names: Golgi-resident adenosine 3'; 5'-bisphosphate 3'-phosphatase; Golgi-resident PAP phosphatase; gPAPP; 3'(2'; 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Myo-inositol monophosphatase A3; Phosphoadenosine phosphate 3'-nucleotidase
Protein name: 3'(2'), 5'-bisphosphate nucleotidase 2
Full length: 359 amino acids
Entry name: IMPA3_HUMAN
Product panel: Enzyme
Deutsch
English
