Recombinant Human METTL14 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCE5

Gene Name: METTL14

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Arg11

End Site: Ile160

Coverage: 0.36

Isoelectric Point: 5

Core Sequence: RQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1627

Alternative protein names: N6-adenosine-methyltransferase non-catalytic subunit; Methyltransferase-like protein 14; hMETTL14

Protein name: methyltransferase 14, N6-adenosine-methyltransferase non-catalytic subunit

Full length: 456 amino acids

Entry name: MET14_HUMAN

• Artikelnummer: ASBPP-2792-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2792-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 57721