Recombinant Human NLGN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZ94

Gene Name: NLGN3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val361

End Site: Asp480

Coverage: 0.15

Isoelectric Point: 4.5

Core Sequence: VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1480; NL3

Alternative protein names: Neuroligin-3; Gliotactin homolog

Protein name: neuroligin 3

Full length: 848 amino acids

Entry name: NLGN3_HUMAN

• Artikelnummer: ASBPP-2858-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2858-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 54413