Recombinant Human PCDHA12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UN75

Gene Name: PCDHA12

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala771

End Site: Glu930

Coverage: 0.18

Isoelectric Point: 9.5

Core Sequence: AFSPSLQLSREDCLNPPSEPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 90%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protocadherin alpha-12; PCDH-alpha-12

Protein name: protocadherin alpha 12

Full length: 941 amino acids

Entry name: PCDAC_HUMAN

• Artikelnummer: ASBPP-2937-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2937-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 56137