Recombinant Human PPP1R1B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UD71

Gene Name: PPP1R1B

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Phe11

End Site: Gln100

Coverage: 0.53

Isoelectric Point: 10

Core Sequence: FSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 88%

Alternative gene names: DARPP32

Alternative protein names: Protein phosphatase 1 regulatory subunit 1B; DARPP-32; Dopamine- and cAMP-regulated neuronal phosphoprotein

Protein name: protein phosphatase 1 regulatory inhibitor subunit 1B

Full length: 204 amino acids

Entry name: PPR1B_HUMAN

Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers

• Artikelnummer: ASBPP-2884-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2884-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84152