Recombinant Human SENP5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96HI0

Gene Name: SENP5

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Phe251

End Site: Ser430

Coverage: 0.25

Isoelectric Point: 6.5

Core Sequence: FRTKSKVCKLRKAQRSWVQKVTGDHQETRRENGEGGSCSPFPSPEPKDPSCRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNGSATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADTSVSSVDGPVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 81%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Sentrin-specific protease 5; Sentrin/SUMO-specific protease SENP5

Protein name: SUMO specific peptidase 5

Full length: 755 amino acids

Entry name: SENP5_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-10341-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10341-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 205564