Recombinant Human SINHCAF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NP50

Gene Name: SINHCAF

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Arg81

End Site: Gly210

Coverage: 0.64

Isoelectric Point: 10

Core Sequence: RAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: C12orf14; FAM60A

Alternative protein names: SIN3-HDAC complex-associated factor; Protein FAM60A; Tera protein homolog

Protein name: SIN3-HDAC complex associated factor

Full length: 221 amino acids

Entry name: SHCAF_HUMAN

• Artikelnummer: ASBPP-2800-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2800-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 58516