Recombinant Human WDR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75083

Gene Name: WDR1

Expression System: Escherichia coli

Molecular Weight: 71 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ser11

End Site: Ile260

Coverage: 0.42

Isoelectric Point: 6.5

Core Sequence: SLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 1; Actin-interacting protein 1; AIP1; NORI-1

Protein name: WD repeat domain 1

Full length: 606 amino acids

Entry name: WDR1_HUMAN

• Artikelnummer: ASBPP-030-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-030-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9948