Recombinant Human WDR3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UNX4

Gene Name: WDR3

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Val691

End Site: Asn840

Coverage: 0.17

Isoelectric Point: 5

Core Sequence: VSSSHDKSLRLWERTREPLILEEEREMEREAEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREETAKMKEHKAICKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSELEESLLVLPFSYVPDILKLFN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 3

Protein name: WD repeat domain 3

Full length: 943 amino acids

Entry name: WDR3_HUMAN

• Artikelnummer: ASBPP-10356-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10356-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10885