Recombinant Human YEATS2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULM3

Gene Name: YEATS2

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Arg1231

End Site: Lys1390

Coverage: 0.12

Isoelectric Point: 5

Core Sequence: RCHGYTPPDPESLRNDGDSIEDVLTQIDSEPECPSSFSSADNLCRKLEDLQQFQKREPENEEEVDILSLSEPVKINIKKEQEEKQEEVKFYLPPTPGSEFIGDVTQKIGITLQPVALHRNVYASVVEDMILKATEQLVNDILRQALAVGYQTASHNRIPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1197

Alternative protein names: YEATS domain-containing protein 2

Protein name: YEATS domain containing 2

Full length: 1422 amino acids

Entry name: YETS2_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2927-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2927-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 55689