Recombinant Human ZNF286A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBT8

Gene Name: ZNF286A

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Lys11

End Site: Val210

Coverage: 0.41

Isoelectric Point: 5

Core Sequence: KGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQRDVMLENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALECENWLENQQGNQERHLREMFTHMNSLSEETDHKHDVYWKSFNQKSVLITEDRV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 53%, Pig - 78%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1874; ZNF286

Alternative protein names: Zinc finger protein 286A

Protein name: zinc finger protein 286A

Full length: 521 amino acids

Entry name: Z286A_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2786-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2786-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57335