Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1)

Research Areas: Others

Uniprot: Q3UR78

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: C-terminal 6xHis-tagged

Purity: Greater than 95% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 13.8 kDa

Gene Names: Nicol1

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 29-90aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: EPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR

Endotoxin: Not test.

• Artikelnummer: CSB-EP662384MO-1
• Hersteller: Cusabio
• Hersteller Artikelnummer: CSB-EP662384MO-1
• Verpackungseinheit: 1 mg
• Mengeneinheit: STK