Recombinant Swine IL-1 alpha protein(N-His)(active)

Recombinant Swine IL-1 alpha protein(N-His)(active)
Artikelnummer
ELSPKSS000001-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Abbreviation: IL-1 alpha

Target Synonym: IL1A

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P18430

Background: Interleukin-1 alpha (IL1α) is a cytokine member of the interleukin-1 family. IL-1 consists of two distinct forms: IL1α and IL1β that recognize the same cell surface receptors but are distinct proteins with approximately 25% amino acid sequence identity. IL1α is constitutively produced by epithelial cells and plays an essential role in maintenance of skin barrier function. Upon stimulation, a wide variety of cells including osteoblasts, monocytes, macrophages can be induced to express IL1α. IL1α possesses a wide range of metabolic, physiological, haematopoietic activities, and is critically involved in the regulation of the immune responses and inflammatory responses.

Activity: Measure by its ability to induce D10.G4. 1 cells proliferation. The ED50 for this effect is 50 pg/mL.

Sequence: MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTSKTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
Mehr Informationen
Artikelnummer ELSPKSS000001-5
Hersteller Elabscience Biotechnology
Hersteller Artikelnummer ELA-PKSS000001-5
Verpackungseinheit 5 µg
Mengeneinheit STK
Methode Cell Culture
Produktinformation (PDF) Download
MSDS (PDF) Download