Recombinant Swine IL-10 protein(N-His)(active)

Recombinant Swine IL-10 protein(N-His)(active)
Artikelnummer
ELSPKSS000007-5
Verpackungseinheit
5 µg
Hersteller
Elabscience Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Abbreviation: IL-10

Target Synonym: B-TCGF;CSIF;TGIF

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q29055

Background: IL-10 is a anti-inflammatory cytokine which belongs to the IL-10 family. It is produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types, while it is produced primarily by monocytes and to a lesser extent by lymphocytes. IL-10 is mainly expressed in monocytes and Type 2 T helper cells (TH2), mast cells, CD4+CD25+Foxp3+ regulatory T cells, and also in a certain subset of activated T cells and B cells. IL-10 has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. The importance of interleukin 10 for counteracting excessive immunity in the human body is revealed by the fact that patients with Crohn's disease react favorably towards treatment with bacteria producing recombinant IL-10. IL-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. It also displays a potent ability to suppress the antigen-presentation capacity of antigen presenting cells. However, it is also stimulatory towards certain T cells and mast cells and stimulates B cell maturation and antibody production.

Activity: Measure by its ability to induce proliferation in MC/9‑2 cells. The ED50 for this effect is < 5 ng/mL.

Sequence: MPSSALLYCLIFLAGVAASIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
Mehr Informationen
Artikelnummer ELSPKSS000007-5
Hersteller Elabscience Biotechnology
Hersteller Artikelnummer ELA-PKSS000007-5
Verpackungseinheit 5 µg
Mengeneinheit STK
Methode Cell Culture
Produktinformation (PDF) Download
MSDS (PDF) Download