English
RFPL3 Antibody - middle region : HRP
RFPL3 Antibody - middle region : HRP
Artikelnummer
AVIARP57945_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The function remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL3
Key Reference: Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947
Molecular Weight: 35kDa
Peptide Sequence: Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ret finger protein-like 3
Protein Size: 317
Purification: Affinity Purified
Description of Target: The function remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL3
Key Reference: Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947
Molecular Weight: 35kDa
Peptide Sequence: Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ret finger protein-like 3
Protein Size: 317
Purification: Affinity Purified
| Artikelnummer | AVIARP57945_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57945_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10738 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
