RGS19 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS19

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: HDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulator of G-protein signaling 19

Protein Size: 217

Purification: Affinity Purified

• Artikelnummer: AVIARP58934_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58934_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10287
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin