RHEB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHEB

Key Reference: Eom,M., (2008) Pathol. Int. 58 (4), 226-232

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein Rheb

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP56651_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56651_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6009
• Wirt: Rabbit