RIC8A Antibody - N-terminal region : FITC

RIC8A Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57567_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIC8A

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synembryn-A

Protein Size: 537

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57567_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57567_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60626
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×