RNF128 Antibody - C-terminal region : Biotin

RNF128 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP59127_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RNF128 is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of RNF128 in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of RNF128 was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase RNF128

Protein Size: 402

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59127_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59127_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79589
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×