Rnf216 Antibody - N-terminal region : HRP

Rnf216 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57824_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase RNF216

Protein Size: 853

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57824_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57824_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 108086
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×