Romo1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Romo1 induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. It may play a role in inducing oxidative DNA damage and replicative senescence.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calmodulin-regulated spectrin-associated protein 1

Protein Size: 79

Purification: Affinity Purified

• Artikelnummer: AVIARP58431_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58431_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 67067
• Wirt: Rabbit
• Konjugat: Conjugated, FITC