RORG Antibody - N-terminal region : FITC

RORG Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59154_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORG

Molecular Weight: 56 kDa

Peptide Sequence: Synthetic peptide located within the following region: DSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nuclear receptor ROR-gamma

Protein Size: 518

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP59154_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59154_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Human Gene ID 6097
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×